PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00250.1.p
Common NameEUGRSUZ_J00250, LOC104421119
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 406aa    MW: 44017.9 Da    PI: 5.666
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-1768113147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+W++eEd  l  +v+++G ++W++Iar ++ gR++k+c++rw + 
  Eucgr.J00250.1.p  68 RGPWSPEEDAVLTGLVAKFGARNWSLIARGIP-GRSGKSCRLRWCNQ 113
                       89******************************.***********985 PP

2Myb_DNA-binding58.91.1e-18120164147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r+++T eEd+++++a++++G++ W++Ia+ ++ gRt++ +k++w++ 
  Eucgr.J00250.1.p 120 RKPFTDEEDLIIIKAHAMHGNK-WAAIAKLLP-GRTDNAIKNHWNST 164
                       789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.40163114IPR017930Myb domain
SuperFamilySSF466898.99E-3166161IPR009057Homeodomain-like
SMARTSM007171.1E-1367116IPR001005SANT/Myb domain
PfamPF002498.0E-1668113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2669121IPR009057Homeodomain-like
CDDcd001673.66E-1370112No hitNo description
PROSITE profilePS5129427.357115169IPR017930Myb domain
SMARTSM007178.4E-18119167IPR001005SANT/Myb domain
PfamPF002496.1E-17120164IPR001005SANT/Myb domain
CDDcd001674.41E-13122165No hitNo description
Gene3DG3DSA:1.10.10.604.6E-25122168IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MKPVGSTKSS IDDDGDGDGE DRATAMDADV NLKEEDDRQL AADEEMPVAD CGGGGGGGGG  60
GAAGSRVRGP WSPEEDAVLT GLVAKFGARN WSLIARGIPG RSGKSCRLRW CNQLDPSVKR  120
KPFTDEEDLI IIKAHAMHGN KWAAIAKLLP GRTDNAIKNH WNSTLRRKGI WLGRSKTRHT  180
DMMEESWPVE TNASSEETLS AGDSQSNRPR DGTEIAVENG LKQNETEAQR MDGLSVAEKT  240
QNTVSRPQPR VSAFRIYKPE KSSSTGSGFS KEIHAQGPSM LTFKTELGVH NFLDDVHSDP  300
KIPPHCGYGC CASPTGFHSE SSLLGPDFVD YEEPPSYSTL DLMSVALDLN NTAWIKTGLV  360
NGGSQIPETG EFRRLRDTNS SYLGLFEPNK KTEHTCFQEG KNKLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-40671686107B-MYB
1h89_C5e-396716857158MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-396716857158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00250.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010031265.10.0PREDICTED: myb-related protein B
TrEMBLA0A059A9M00.0A0A059A9M0_EUCGR; Uncharacterized protein
STRINGVIT_13s0019g03200.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.19e-93myb domain protein 109